PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G149700.1
Common NamePHAVU_007G149700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family TCP
Protein Properties Length: 189aa    MW: 20012.6 Da    PI: 8.2861
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G149700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP111.71.1e-3441118380
                 TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaessss 80 
                         + +++++++hTkv+gR+RRvR++ +caar+F+L++eLG+ +d++tieWLl+ a+p+i+++tg+++ ++   ++++ s 
  Phvul.007G149700.1  41 AVTRSTKDRHTKVNGRGRRVRMPPLCAARIFQLTRELGHRSDGETIEWLLRHAEPSIIAATGSGTVPSAPISSVATSI 118
                         55789**********************************************************777773332222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.2E-3045146IPR005333Transcription factor, TCP
PROSITE profilePS5136927.0446100IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MTSHVVLQNF PHSETKLSTT TTSDSPPTAP SLAVTKRTSA AVTRSTKDRH TKVNGRGRRV  60
RMPPLCAARI FQLTRELGHR SDGETIEWLL RHAEPSIIAA TGSGTVPSAP ISSVATSIPS  120
SESSVSVPVV GGQGMFSMAP PSCRLDLSPP PGMEFAASNG YRHMPFTALL LQPATVEDNQ  180
NDESLGEH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007144360.11e-135hypothetical protein PHAVU_007G149700g
SwissprotQ9SJK72e-43TCP11_ARATH; Transcription factor TCP11
TrEMBLV7BET01e-135V7BET0_PHAVU; Uncharacterized protein
STRINGGLYMA13G20710.27e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.11e-42TCP family protein